Recombinant Human USP39, His-tagged
Cat.No. : | USP39-29614TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 328-565 of Human USP39 with N terminal His tag; MWt 33 kDa , |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 328-565 a.a. |
Description : | U4/U6.U5 tri-snRNP-associated protein 2 is a protein that in humans is encoded by the USP39 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 63 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPA EEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEK EQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQL TKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLR EYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDE TNQQGA |
Sequence Similarities : | Belongs to the peptidase C19 family.Contains 1 UBP-type zinc finger. |
Gene Name | USP39 ubiquitin specific peptidase 39 [ Homo sapiens ] |
Official Symbol | USP39 |
Synonyms | USP39; ubiquitin specific peptidase 39; ubiquitin specific protease 39; U4/U6.U5 tri-snRNP-associated protein 2; CGI 21; SAD1; small nuclear ribonucleoprotein 65kDa (U4/U6.U5); snRNP assembly defective 1 homolog (S.cerevisiae); SNRNP65; |
Gene ID | 10713 |
mRNA Refseq | NM_006590 |
Protein Refseq | NP_006581 |
MIM | 611594 |
Uniprot ID | Q53GS9 |
Chromosome Location | 2p11.2 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem; |
Function | metal ion binding; ubiquitin thiolesterase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
USP39-29614TH | Recombinant Human USP39, His-tagged | +Inquiry |
USP39-17927M | Recombinant Mouse USP39 Protein | +Inquiry |
USP39-2328H | Recombinant Human USP39 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP39-1264HFL | Recombinant Full Length Human USP39 Protein, C-Flag-tagged | +Inquiry |
USP39-5128R | Recombinant Rhesus monkey USP39 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP39-457HCL | Recombinant Human USP39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP39 Products
Required fields are marked with *
My Review for All USP39 Products
Required fields are marked with *
0
Inquiry Basket