Recombinant Human USP53 protein, His-tagged
Cat.No. : | USP53-3260H |
Product Overview : | Recombinant Human USP53 protein(371-600 aa), fused to His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 371-600 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSHSHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDLVDEDLSHFQSGSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSES |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | USP53 ubiquitin specific peptidase 53 [ Homo sapiens ] |
Official Symbol | USP53 |
Synonyms | USP53; ubiquitin specific peptidase 53; ubiquitin specific protease 53; inactive ubiquitin carboxyl-terminal hydrolase 53; KIAA1350; ubiquitin specific proteinase 53; inactive ubiquitin-specific peptidase 53; DKFZp781E1417; |
Gene ID | 54532 |
mRNA Refseq | NM_019050 |
Protein Refseq | NP_061923 |
UniProt ID | Q70EK8 |
◆ Recombinant Proteins | ||
USP53-1273H | Recombinant Human USP53 Protein (K30-P351), Tag Free | +Inquiry |
USP53-9974M | Recombinant Mouse USP53 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP53-17940M | Recombinant Mouse USP53 Protein | +Inquiry |
USP53-111H | Recombinant Human USP53 protein, His-tagged | +Inquiry |
USP53-3260H | Recombinant Human USP53 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP53-1898HCL | Recombinant Human USP53 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP53 Products
Required fields are marked with *
My Review for All USP53 Products
Required fields are marked with *