Recombinant Human USPL1 protein, GST-tagged
Cat.No. : | USPL1-301333H |
Product Overview : | Recombinant Human USPL1 (31-220 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu31-Ser220 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LGKNFDSAKVPSDEYCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNPIRTADSLERNEILEADTVDMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKCTS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | USPL1 ubiquitin specific peptidase like 1 [ Homo sapiens ] |
Official Symbol | USPL1 |
Synonyms | USPL1; ubiquitin specific peptidase like 1; C13orf22, chromosome 13 open reading frame 22; ubiquitin-specific peptidase-like protein 1; bA121O19.1; D13S106E; highly charged protein; C13orf22; FLJ32952; RP11-121O19.1; DKFZp781K2286; |
Gene ID | 10208 |
mRNA Refseq | NM_005800 |
Protein Refseq | NP_005791 |
UniProt ID | Q5W0Q7 |
◆ Recombinant Proteins | ||
USPL1-301333H | Recombinant Human USPL1 protein, GST-tagged | +Inquiry |
USPL1-1167Z | Recombinant Zebrafish USPL1 | +Inquiry |
USPL1-524H | Recombinant Human USPL1 Protein, GST-tagged | +Inquiry |
USPL1-17947M | Recombinant Mouse USPL1 Protein | +Inquiry |
USPL1-2942H | Recombinant Human USPL1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USPL1 Products
Required fields are marked with *
My Review for All USPL1 Products
Required fields are marked with *
0
Inquiry Basket