Recombinant Human USPL1 protein, GST-tagged
| Cat.No. : | USPL1-301333H | 
| Product Overview : | Recombinant Human USPL1 (31-220 aa) protein, fused to GST tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | Leu31-Ser220 | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| AA Sequence : | LGKNFDSAKVPSDEYCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNPIRTADSLERNEILEADTVDMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKCTS | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.  | 
                                
| Gene Name | USPL1 ubiquitin specific peptidase like 1 [ Homo sapiens ] | 
| Official Symbol | USPL1 | 
| Synonyms | USPL1; ubiquitin specific peptidase like 1; C13orf22, chromosome 13 open reading frame 22; ubiquitin-specific peptidase-like protein 1; bA121O19.1; D13S106E; highly charged protein; C13orf22; FLJ32952; RP11-121O19.1; DKFZp781K2286; | 
| Gene ID | 10208 | 
| mRNA Refseq | NM_005800 | 
| Protein Refseq | NP_005791 | 
| UniProt ID | Q5W0Q7 | 
| ◆ Recombinant Proteins | ||
| USPL1-2942H | Recombinant Human USPL1 protein, His-tagged | +Inquiry | 
| USPL1-301333H | Recombinant Human USPL1 protein, GST-tagged | +Inquiry | 
| USPL1-524H | Recombinant Human USPL1 Protein, GST-tagged | +Inquiry | 
| USPL1-9978M | Recombinant Mouse USPL1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| USPL1-17947M | Recombinant Mouse USPL1 Protein | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All USPL1 Products
Required fields are marked with *
My Review for All USPL1 Products
Required fields are marked with *
  
        
    
      
            