Recombinant Human UTP20 Protein, GST-tagged

Cat.No. : UTP20-4054H
Product Overview : Human DRIM partial ORF ( NP_055318, 946 a.a. - 1053 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : UTP20 is a component of the U3 small nucleolar RNA (snoRNA) (SNORD3A; MIM 180710) protein complex (U3 snoRNP) and is involved in 18S rRNA processing (Wang et al., 2007 [PubMed 17498821]).[supplied by OMIM, Jun 2009]
Molecular Mass : 37.62 kDa
AA Sequence : LHQDQMVQKITLDCIMTYKHPHVLPYRENLQRLLEDRSFKEEIVHFSISEDNAVVKTAHRADLFPILMRILYGRMKNKTGSKTQGKSASGTRMAIVLRFLAGTQPEEI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UTP20 UTP20, small subunit (SSU) processome component, homolog (yeast) [ Homo sapiens ]
Official Symbol UTP20
Synonyms UTP20; UTP20, small subunit (SSU) processome component, homolog (yeast); small subunit processome component 20 homolog; down regulated in metastasis; DRIM; NNP73; novel nucleolar protein 73; down-regulated in metastasis protein;
Gene ID 27340
mRNA Refseq NM_014503
Protein Refseq NP_055318
MIM 612822
UniProt ID O75691

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UTP20 Products

Required fields are marked with *

My Review for All UTP20 Products

Required fields are marked with *

0
cart-icon