Recombinant Human UTP20 Protein, GST-tagged
Cat.No. : | UTP20-4054H |
Product Overview : | Human DRIM partial ORF ( NP_055318, 946 a.a. - 1053 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | UTP20 is a component of the U3 small nucleolar RNA (snoRNA) (SNORD3A; MIM 180710) protein complex (U3 snoRNP) and is involved in 18S rRNA processing (Wang et al., 2007 [PubMed 17498821]).[supplied by OMIM, Jun 2009] |
Molecular Mass : | 37.62 kDa |
AA Sequence : | LHQDQMVQKITLDCIMTYKHPHVLPYRENLQRLLEDRSFKEEIVHFSISEDNAVVKTAHRADLFPILMRILYGRMKNKTGSKTQGKSASGTRMAIVLRFLAGTQPEEI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UTP20 UTP20, small subunit (SSU) processome component, homolog (yeast) [ Homo sapiens ] |
Official Symbol | UTP20 |
Synonyms | UTP20; UTP20, small subunit (SSU) processome component, homolog (yeast); small subunit processome component 20 homolog; down regulated in metastasis; DRIM; NNP73; novel nucleolar protein 73; down-regulated in metastasis protein; |
Gene ID | 27340 |
mRNA Refseq | NM_014503 |
Protein Refseq | NP_055318 |
MIM | 612822 |
UniProt ID | O75691 |
◆ Recombinant Proteins | ||
UTP20-4054H | Recombinant Human UTP20 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UTP20 Products
Required fields are marked with *
My Review for All UTP20 Products
Required fields are marked with *