Recombinant Human UTP20 Protein, GST-tagged

• Cat.No.: UTP20-4054H
• Product Overview: Human DRIM partial ORF ( NP_055318, 946 a.a. - 1053 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: UTP20 is a component of the U3 small nucleolar RNA (snoRNA) (SNORD3A; MIM 180710) protein complex (U3 snoRNP) and is involved in 18S rRNA processing (Wang et al., 2007 [PubMed 17498821]).[supplied by OMIM, Jun 2009]
• Molecular Mass: 37.62 kDa
• AA Sequence: LHQDQMVQKITLDCIMTYKHPHVLPYRENLQRLLEDRSFKEEIVHFSISEDNAVVKTAHRADLFPILMRILYGRMKNKTGSKTQGKSASGTRMAIVLRFLAGTQPEEI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UTP20 UTP20, small subunit (SSU) processome component, homolog (yeast) [ Homo sapiens ]
• Official Symbol: UTP20
• Synonyms: UTP20; UTP20, small subunit (SSU) processome component, homolog (yeast); small subunit processome component 20 homolog; down regulated in metastasis; DRIM; NNP73; novel nucleolar protein 73; down-regulated in metastasis protein
• Gene ID: 27340
• mRNA Refseq: NM_014503
• Protein Refseq: NP_055318
• MIM: 612822
• UniProt ID: O75691