Recombinant Human UTY protein, GST-tagged
Cat.No. : | UTY-6732H |
Product Overview : | Recombinant Human UTY protein(560-655 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 560-655 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | QQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | UTY ubiquitously transcribed tetratricopeptide repeat gene, Y-linked [ Homo sapiens ] |
Official Symbol | UTY |
Synonyms | UTY; ubiquitously transcribed tetratricopeptide repeat gene, Y-linked; ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome; histone demethylase UTY; ubiquitous TPR motif protein UTY; ubiquitously transcribed TPR gene on Y chromosome; ubiquitously-transcribed TPR protein on the Y chromosome; ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein; UTY1; DKFZp686L12190; |
Gene ID | 7404 |
mRNA Refseq | NM_001258263 |
Protein Refseq | NP_001245192 |
MIM | 400009 |
UniProt ID | O14607 |
◆ Recombinant Proteins | ||
UTY-643C | Recombinant Chimpanzee UTY protein(209-317aa), His&Myc-tagged | +Inquiry |
UTY-6733H | Recombinant Human UTY protein, His-tagged | +Inquiry |
UTY-6732H | Recombinant Human UTY protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UTY Products
Required fields are marked with *
My Review for All UTY Products
Required fields are marked with *