Recombinant Human UTY protein, GST-tagged
| Cat.No. : | UTY-6732H | 
| Product Overview : | Recombinant Human UTY protein(560-655 aa), fused with N-terminal GST tag, was expressed in E.coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 560-655 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. | 
| AASequence : | QQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATS | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | UTY ubiquitously transcribed tetratricopeptide repeat gene, Y-linked [ Homo sapiens ] | 
| Official Symbol | UTY | 
| Synonyms | UTY; ubiquitously transcribed tetratricopeptide repeat gene, Y-linked; ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome; histone demethylase UTY; ubiquitous TPR motif protein UTY; ubiquitously transcribed TPR gene on Y chromosome; ubiquitously-transcribed TPR protein on the Y chromosome; ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein; UTY1; DKFZp686L12190; | 
| Gene ID | 7404 | 
| mRNA Refseq | NM_001258263 | 
| Protein Refseq | NP_001245192 | 
| MIM | 400009 | 
| UniProt ID | O14607 | 
| ◆ Recombinant Proteins | ||
| UTY-6732H | Recombinant Human UTY protein, GST-tagged | +Inquiry | 
| UTY-643C | Recombinant Chimpanzee UTY protein(209-317aa), His&Myc-tagged | +Inquiry | 
| UTY-6733H | Recombinant Human UTY protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All UTY Products
Required fields are marked with *
My Review for All UTY Products
Required fields are marked with *
  
        
    
      
            