Recombinant Human VAMP3
Cat.No. : | VAMP3-27011TH |
Product Overview : | Recombinant fragment of Human Cellubrevin , 8.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 77 amino acids |
Description : | Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Because of its high homology to other known VAMPs, its broad tissue distribution, and its subcellular localization, the protein encoded by this gene was shown to be the human equivalent of the rodent cellubrevin. In platelets the protein resides on a compartment that is not mobilized to the plasma membrane on calcium or thrombin stimulation. |
Molecular Weight : | 8.700kDa |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 7.50Constituents:0.24% Tris, 10% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK |
Sequence Similarities : | Belongs to the synaptobrevin family.Contains 1 v-SNARE coiled-coil homology domain. |
Gene Name | VAMP3 vesicle-associated membrane protein 3 (cellubrevin) [ Homo sapiens ] |
Official Symbol | VAMP3 |
Synonyms | VAMP3; vesicle-associated membrane protein 3 (cellubrevin); vesicle-associated membrane protein 3; CEB; |
Gene ID | 9341 |
mRNA Refseq | NM_004781 |
Protein Refseq | NP_004772 |
MIM | 603657 |
Uniprot ID | Q15836 |
Chromosome Location | 1p36.23 |
Pathway | Arf6 trafficking events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem; |
Function | SNARE binding; protein binding; syntaxin-1 binding; |
◆ Recombinant Proteins | ||
VAMP3-1084C | Recombinant Cynomolgus VAMP3 Protein, His-tagged | +Inquiry |
VAMP3-4955R | Recombinant Rhesus Macaque VAMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP3-306Z | Recombinant Zebrafish VAMP3 | +Inquiry |
VAMP3-3640H | Recombinant Human VAMP3, GST-tagged | +Inquiry |
VAMP3-1070H | Recombinant Human VAMP3 protein(Met1-Lys77), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP3-437HCL | Recombinant Human VAMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAMP3 Products
Required fields are marked with *
My Review for All VAMP3 Products
Required fields are marked with *