Recombinant Human VAMP4 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: VAMP4-402H
• Product Overview: VAMP4 MS Standard C13 and N15-labeled recombinant protein (NP_003753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008]
• Molecular Mass: 16.2 kDa
• AA Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: VAMP4 vesicle-associated membrane protein 4 [ Homo sapiens (human) ]
• Official Symbol: VAMP4
• Synonyms: VAMP4; vesicle-associated membrane protein 4; VAMP-4; VAMP24
• Gene ID: 8674
• mRNA Refseq: NM_003762
• Protein Refseq: NP_003753
• MIM: 606909
• UniProt ID: O75379