Recombinant Human VAMP4 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | VAMP4-402H |
Product Overview : | VAMP4 MS Standard C13 and N15-labeled recombinant protein (NP_003753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | VAMP4 vesicle-associated membrane protein 4 [ Homo sapiens (human) ] |
Official Symbol | VAMP4 |
Synonyms | VAMP4; vesicle-associated membrane protein 4; VAMP-4; VAMP24; |
Gene ID | 8674 |
mRNA Refseq | NM_003762 |
Protein Refseq | NP_003753 |
MIM | 606909 |
UniProt ID | O75379 |
◆ Recombinant Proteins | ||
VAMP4-4283H | Recombinant Human VAMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP4-819H | Recombinant Human VAMP4 | +Inquiry |
RFL15588HF | Recombinant Full Length Human Vesicle-Associated Membrane Protein 4(Vamp4) Protein, His-Tagged | +Inquiry |
VAMP4-10998Z | Recombinant Zebrafish VAMP4 | +Inquiry |
Vamp4-6892M | Recombinant Mouse Vamp4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP4-436HCL | Recombinant Human VAMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAMP4 Products
Required fields are marked with *
My Review for All VAMP4 Products
Required fields are marked with *