Recombinant Human VAPA Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | VAPA-6228H |
| Product Overview : | VAPA MS Standard C13 and N15-labeled recombinant protein (NP_919415) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
| Molecular Mass : | 27.9 kDa |
| AA Sequence : | MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | VAPA VAMP associated protein A [ Homo sapiens (human) ] |
| Official Symbol | VAPA |
| Synonyms | VAPA; VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa; VAMP (vesicle associated membrane protein) associated protein A (33kD); vesicle-associated membrane protein-associated protein A; hVAP 33; VAP A; VAMP-A; VAMP-associated protein A; 33 kDa VAMP-associated protein; VAP-A; VAP33; VAP-33; hVAP-33; MGC3745; |
| Gene ID | 9218 |
| mRNA Refseq | NM_194434 |
| Protein Refseq | NP_919415 |
| MIM | 605703 |
| UniProt ID | Q9P0L0 |
| ◆ Recombinant Proteins | ||
| VAPA-6498R | Recombinant Rat VAPA Protein | +Inquiry |
| VAPA-30991TH | Recombinant Human VAPA, His-tagged | +Inquiry |
| VAPA-287H | Recombinant Human VAPA Protein, His-tagged | +Inquiry |
| VAPA-10287Z | Recombinant Zebrafish VAPA | +Inquiry |
| VAPA-3626C | Recombinant Chicken VAPA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VAPA-431HCL | Recombinant Human VAPA 293 Cell Lysate | +Inquiry |
| VAPA-467HKCL | Human VAPA Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAPA Products
Required fields are marked with *
My Review for All VAPA Products
Required fields are marked with *
