"VASH1" Related Products

Expand
Expand

Recombinant Human VASH1 protein, GST-tagged

Cat.No.: VASH1-13H
Product Overview: Recombinant Human VASH1(1 a.a. - 204 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: VASH1 played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 48.2 kDa
AA Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWE RMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPL TGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: VASH1 vasohibin 1 [ Homo sapiens ]
Official Symbol: VASH1
Synonyms: VASH1; vasohibin 1; KIAA1036; vasohibin-1;
Gene ID: 22846
mRNA Refseq: NM_014909
Protein Refseq: NP_055724
MIM: 609011
UniProt ID: Q7L8A9
Chromosome Location: 14q24.3

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.