Recombinant Human VASH1 protein, GST-tagged

Cat.No. : VASH1-13H
Product Overview : Recombinant Human VASH1(1 a.a. - 204 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-204 a.a.
Description : VASH1 played an important role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 48.2 kDa
AA Sequence : MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWE RMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPL TGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name VASH1 vasohibin 1 [ Homo sapiens ]
Official Symbol VASH1
Synonyms VASH1; vasohibin 1; KIAA1036; vasohibin-1;
Gene ID 22846
mRNA Refseq NM_014909
Protein Refseq NP_055724
MIM 609011
UniProt ID Q7L8A9
Chromosome Location 14q24.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VASH1 Products

Required fields are marked with *

My Review for All VASH1 Products

Required fields are marked with *

0
cart-icon