Recombinant Human VASH1 protein, GST-tagged
Cat.No. : | VASH1-13H |
Product Overview : | Recombinant Human VASH1(1 a.a. - 204 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-204 a.a. |
Description : | VASH1 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWE RMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPL TGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | VASH1 vasohibin 1 [ Homo sapiens ] |
Official Symbol | VASH1 |
Synonyms | VASH1; vasohibin 1; KIAA1036; vasohibin-1; |
Gene ID | 22846 |
mRNA Refseq | NM_014909 |
Protein Refseq | NP_055724 |
MIM | 609011 |
UniProt ID | Q7L8A9 |
Chromosome Location | 14q24.3 |
◆ Recombinant Proteins | ||
VASH1-3095HFL | Recombinant Full Length Human VASH1 protein, Flag-tagged | +Inquiry |
VASH1-4960R | Recombinant Rhesus Macaque VASH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VASH1-12H | Recombinant Human VASH1 protein, MYC/DDK-tagged | +Inquiry |
Vash1-6898M | Recombinant Mouse Vash1 Protein, Myc/DDK-tagged | +Inquiry |
VASH1-3096HFL | Recombinant Full Length Human VASH1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASH1-428HCL | Recombinant Human VASH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VASH1 Products
Required fields are marked with *
My Review for All VASH1 Products
Required fields are marked with *
0
Inquiry Basket