Recombinant Human VASH1 protein, GST-tagged
| Cat.No. : | VASH1-13H |
| Product Overview : | Recombinant Human VASH1(1 a.a. - 204 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-204 a.a. |
| Description : | VASH1 played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 48.2 kDa |
| AA Sequence : | MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWE RMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPL TGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | VASH1 vasohibin 1 [ Homo sapiens ] |
| Official Symbol | VASH1 |
| Synonyms | VASH1; vasohibin 1; KIAA1036; vasohibin-1; |
| Gene ID | 22846 |
| mRNA Refseq | NM_014909 |
| Protein Refseq | NP_055724 |
| MIM | 609011 |
| UniProt ID | Q7L8A9 |
| Chromosome Location | 14q24.3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VASH1 Products
Required fields are marked with *
My Review for All VASH1 Products
Required fields are marked with *



