Recombinant Human VASN protein, His-tagged
| Cat.No. : | VASN-3650H |
| Product Overview : | Recombinant Human VASN protein(25-349 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | May 23, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-349 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | PSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | VASN |
| Synonyms | VASN; vasorin; slit like 2 (Drosophila) , SLITL2; slit-like 2; protein slit-like 2; SLITL2; |
| Gene ID | 114990 |
| mRNA Refseq | NM_138440 |
| Protein Refseq | NP_612449 |
| MIM | 608843 |
| UniProt ID | Q6EMK4 |
| ◆ Recombinant Proteins | ||
| VASN-17985M | Active Recombinant Mouse VASN Protein, C-His-tagged | +Inquiry |
| VASN-7764H | Recombinant Human VASN, His-tagged | +Inquiry |
| VASN-596H | Recombinant Human VASN Protein, His-tagged | +Inquiry |
| Vasn-597M | Recombinant Mouse Vasn Protein, His-tagged | +Inquiry |
| Vasn-12M | Active Recombinant Mouse Vasn Protein (Cys25-Pro576), C-6×His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VASN-1392HCL | Recombinant Human VASN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VASN Products
Required fields are marked with *
My Review for All VASN Products
Required fields are marked with *
