Recombinant Human VASN protein, His-tagged
Cat.No. : | VASN-3650H |
Product Overview : | Recombinant Human VASN protein(25-349 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-349 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | PSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | VASN |
Synonyms | VASN; vasorin; slit like 2 (Drosophila) , SLITL2; slit-like 2; protein slit-like 2; SLITL2; |
Gene ID | 114990 |
mRNA Refseq | NM_138440 |
Protein Refseq | NP_612449 |
MIM | 608843 |
UniProt ID | Q6EMK4 |
◆ Recombinant Proteins | ||
VASN-9998M | Recombinant Mouse VASN Protein, His (Fc)-Avi-tagged | +Inquiry |
VASN-5601H | Recombinant Human VASN Protein (Pro25-Cys349), N-His tagged | +Inquiry |
VASN-17985M | Active Recombinant Mouse VASN Protein, C-His-tagged | +Inquiry |
VASN-8615H | Recombinant Human VASN protein, His-tagged | +Inquiry |
VASN-2895H | Recombinant Human VASN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASN-1392HCL | Recombinant Human VASN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VASN Products
Required fields are marked with *
My Review for All VASN Products
Required fields are marked with *