Recombinant Human VAV3 protein, His-tagged
Cat.No. : | VAV3-7856H |
Product Overview : | Recombinant Human VAV3 protein(546-847 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 546-847 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | KCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | VAV3 vav 3 guanine nucleotide exchange factor [ Homo sapiens ] |
Official Symbol | VAV3 |
Synonyms | VAV3; vav 3 guanine nucleotide exchange factor; vav 3 oncogene; guanine nucleotide exchange factor VAV3; VAV-3; FLJ40431; |
mRNA Refseq | NM_001079874 |
Protein Refseq | NP_001073343 |
MIM | 605541 |
UniProt ID | Q9UKW4 |
Gene ID | 10451 |
◆ Recombinant Proteins | ||
VAV3-7087C | Recombinant Chicken VAV3 | +Inquiry |
VAV3-1385H | Recombinant Human VAV3 protein, His-tagged | +Inquiry |
VAV3-7855H | Recombinant Human VAV3 protein, GST-tagged | +Inquiry |
VAV3-1909HFL | Recombinant Full Length Human VAV3 Protein, C-Flag-tagged | +Inquiry |
VAV3-6117H | Recombinant Human VAV3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAV3 Products
Required fields are marked with *
My Review for All VAV3 Products
Required fields are marked with *