Recombinant Human VDR protein, His-tagged

Cat.No. : VDR-3659H
Product Overview : Recombinant Human VDR protein(79-427 aa) is expressed from E.coli with His tag at the N-Terminus.
Availability July 24, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 79-427 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : CRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Publications :
Gene Name VDR vitamin D (1,25- dihydroxyvitamin D3) receptor [ Homo sapiens ]
Official Symbol VDR
Synonyms VDR; vitamin D (1,25- dihydroxyvitamin D3) receptor; vitamin D3 receptor; NR1I1; 1,25-dihydroxyvitamin D3 receptor; vitamin D nuclear receptor variant 1; nuclear receptor subfamily 1 group I member 1;
Gene ID 7421
mRNA Refseq NM_000376
Protein Refseq NP_000367
MIM 601769
UniProt ID P11473

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VDR Products

Required fields are marked with *

My Review for All VDR Products

Required fields are marked with *

0
cart-icon
0
compare icon