Recombinant Human VDR protein, T7/His-tagged

Cat.No. : VDR-200H
Product Overview : Recombinant human VDR cDNA (426aa, derived from BC060832) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGF FRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRP KLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMM DSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIM LRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQ DAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVF GNEIS
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name VDR vitamin D (1,25- dihydroxyvitamin D3) receptor [ Homo sapiens ]
Official Symbol VDR
Synonyms VDR; vitamin D (1,25- dihydroxyvitamin D3) receptor; vitamin D3 receptor; NR1I1; 1,25-dihydroxyvitamin D3 receptor; vitamin D nuclear receptor variant 1; nuclear receptor subfamily 1 group I member 1;
Gene ID 7421
mRNA Refseq NM_000376
Protein Refseq NP_000367
MIM 601769
UniProt ID P11473
Chromosome Location 12q12-q14
Pathway Direct p53 effectors, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function DNA binding; metal ion binding; protein binding; receptor activity; retinoid X receptor binding; sequence-specific DNA binding; contributes_to sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; contributes_to v

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VDR Products

Required fields are marked with *

My Review for All VDR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon