Recombinant Human VDR protein, T7/His-tagged
| Cat.No. : | VDR-200H |
| Product Overview : | Recombinant human VDR cDNA (426aa, derived from BC060832) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGF FRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRP KLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMM DSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIM LRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQ DAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVF GNEIS |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | VDR vitamin D (1,25- dihydroxyvitamin D3) receptor [ Homo sapiens ] |
| Official Symbol | VDR |
| Synonyms | VDR; vitamin D (1,25- dihydroxyvitamin D3) receptor; vitamin D3 receptor; NR1I1; 1,25-dihydroxyvitamin D3 receptor; vitamin D nuclear receptor variant 1; nuclear receptor subfamily 1 group I member 1; |
| Gene ID | 7421 |
| mRNA Refseq | NM_000376 |
| Protein Refseq | NP_000367 |
| MIM | 601769 |
| UniProt ID | P11473 |
| Chromosome Location | 12q12-q14 |
| Pathway | Direct p53 effectors, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; |
| Function | DNA binding; metal ion binding; protein binding; receptor activity; retinoid X receptor binding; sequence-specific DNA binding; contributes_to sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; contributes_to v |
| ◆ Recombinant Proteins | ||
| VDR-31130TH | Recombinant Human VDR | +Inquiry |
| VDR-1204H | Active Recombinant Human vitamin D receptor | +Inquiry |
| VDR-6169R | Recombinant Rat VDR Protein, His (Fc)-Avi-tagged | +Inquiry |
| VDR-2560H | Recombinant Human VDR, His-tagged | +Inquiry |
| VDR-6513R | Recombinant Rat VDR Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VDR-462HCL | Recombinant Human VDR cell lysate | +Inquiry |
| VDR-001MCL | Recombinant Mouse VDR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VDR Products
Required fields are marked with *
My Review for All VDR Products
Required fields are marked with *
