| Species : |
Human |
| Source : |
Insect Cells |
| Tag : |
His |
| Description : |
This gene encodes a component of a ubiquitination complex. The encoded protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. In addition to oxygen-related gene expression, this protein plays a role in many other cellular processes including cilia formation, cytokine signaling, regulation of senescence, and formation of the extracellular matrix. Variants of this gene are associated with von Hippel-Lindau syndrome, pheochromocytoma, erythrocytosis, renal cell carcinoma, and cerebellar hemangioblastoma. |
| Form : |
The protein is in 20mM Tris-HCl pH7.9,100mM NaCl, 0.2mM EDTA, 1mM DTT and 20% glycerol. |
| Molecular Mass : |
26.0 kDa |
| AASequence : |
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
| Purity : |
> 90% homogeneous based on SDS-PAGE analysis. |
| Applications : |
Purified VHL protein has been used for in vitro transcriptional activation and protein-protein interaction assays. |
| Storage : |
Stored at -70 centigrade before use. Avoid repeated freeze thaw cycles. |
| Unit Definition : |
1 unit equals 1 nanogram of purified protein. 30-100 units (ng) are required for an in vitro transcription assay and protein-protein interaction assay. |
