Recombinant Human VKORC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | VKORC1-4806H |
| Product Overview : | VKORC1 MS Standard C13 and N15-labeled recombinant protein (NP_996560) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 9.7 kDa |
| AA Sequence : | MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGVSRWFCLPGLDPVLRALTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | VKORC1 vitamin K epoxide reductase complex subunit 1 [ Homo sapiens (human) ] |
| Official Symbol | VKORC1 |
| Synonyms | VKORC1; vitamin K epoxide reductase complex, subunit 1; vitamin K dependent clotting factors deficiency 2, VKCFD2; vitamin K epoxide reductase complex subunit 1; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K dependent clotting factors deficiency 2; vitamin K1 epoxide reductase (warfarin-sensitive); VKOR; MST134; MST576; VKCFD2; EDTP308; IMAGE3455200; MGC2694; FLJ00289; |
| Gene ID | 79001 |
| mRNA Refseq | NM_206824 |
| Protein Refseq | NP_996560 |
| MIM | 608547 |
| UniProt ID | Q9BQB6 |
| ◆ Recombinant Proteins | ||
| VKORC1-08H | Recombinant Human VKORC1-sfGFP Protein (M1-H163 end), C-10×His-tagged | +Inquiry |
| VKORC1-4806H | Recombinant Human VKORC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| VKORC1-20H | Recombinant Human VKORC1-GFP Protein (S3-E155), C-10×His-tagged | +Inquiry |
| Vkorc1-6925M | Recombinant Mouse Vkorc1 Protein, Myc/DDK-tagged | +Inquiry |
| VKORC1-10023M | Recombinant Mouse VKORC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VKORC1-405HCL | Recombinant Human VKORC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VKORC1 Products
Required fields are marked with *
My Review for All VKORC1 Products
Required fields are marked with *
