Recombinant Human VMA21 protein, GST-tagged
Cat.No. : | VMA21-3666H |
Product Overview : | Recombinant Human VMA21 protein(1-101 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-101 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | VMA21 |
Synonyms | VMA21; VMA21 vacuolar H+-ATPase homolog (S. cerevisiae); MEAX, myopathy with excessive autophagy; vacuolar ATPase assembly integral membrane protein VMA21; XMEA; myopathy with excessive autophagy protein; MEAX; MGC125514; MGC125516; MGC131652; |
Gene ID | 203547 |
mRNA Refseq | NM_001017980 |
Protein Refseq | NP_001017980 |
UniProt ID | Q3ZAQ7 |
◆ Cell & Tissue Lysates | ||
VMA21-403HCL | Recombinant Human VMA21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VMA21 Products
Required fields are marked with *
My Review for All VMA21 Products
Required fields are marked with *
0
Inquiry Basket