Recombinant Human VOPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: VOPP1-549H
• Product Overview: VOPP1 MS Standard C13 and N15-labeled recombinant protein (NP_110423) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed.
• Molecular Mass: 19 kDa
• AA Sequence: MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: VOPP1 VOPP1 WW domain binding protein [ Homo sapiens (human) ]
• Official Symbol: VOPP1
• Synonyms: VOPP1; vesicular, overexpressed in cancer, prosurvival protein 1; DKFZp564K0822; ECop; EGFR coamplified and overexpressed protein; FLJ20532; GASP; Glioblastoma amplified secreted protein; Glioblastoma-amplified secreted protein; EGFR-coamplified and overexpressed protein; putative NF-kappa-B-activating protein 055N; ECOP
• Gene ID: 81552
• mRNA Refseq: NM_030796
• Protein Refseq: NP_110423
• MIM: 611915
• UniProt ID: Q96AW1