Recombinant Human VOPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VOPP1-549H
Product Overview : VOPP1 MS Standard C13 and N15-labeled recombinant protein (NP_110423) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed.
Molecular Mass : 19 kDa
AA Sequence : MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VOPP1 VOPP1 WW domain binding protein [ Homo sapiens (human) ]
Official Symbol VOPP1
Synonyms VOPP1; vesicular, overexpressed in cancer, prosurvival protein 1; DKFZp564K0822; ECop; EGFR coamplified and overexpressed protein; FLJ20532; GASP; Glioblastoma amplified secreted protein; Glioblastoma-amplified secreted protein; EGFR-coamplified and overexpressed protein; putative NF-kappa-B-activating protein 055N; ECOP;
Gene ID 81552
mRNA Refseq NM_030796
Protein Refseq NP_110423
MIM 611915
UniProt ID Q96AW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VOPP1 Products

Required fields are marked with *

My Review for All VOPP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon