Recombinant Human VPREB1 protein, His-SUMO-tagged
Cat.No. : | VPREB1-3756H |
Product Overview : | Recombinant Human VPREB1 protein(P12018)(20-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-145aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | VPREB1 pre-B lymphocyte 1 [ Homo sapiens ] |
Official Symbol | VPREB1 |
Synonyms | VPREB1; pre-B lymphocyte 1; immunoglobulin iota chain; CD179A; VpreB; CD179a; v(pre)B protein; CD179 antigen-like family member A; IGI; IGVPB; VPREB; |
Gene ID | 7441 |
mRNA Refseq | NM_007128 |
Protein Refseq | NP_009059 |
MIM | 605141 |
UniProt ID | P12018 |
◆ Recombinant Proteins | ||
VPREB1-10056M | Recombinant Mouse VPREB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VPREB1-5160H | Recombinant Human VPREB1 Protein (Met1-Pro145), C-His tagged | +Inquiry |
VPREB1-3756H | Recombinant Human VPREB1 protein, His-SUMO-tagged | +Inquiry |
VPREB1-18355M | Recombinant Mouse VPREB1 Protein | +Inquiry |
VPREB1-0913H | Recombinant Human VPREB1 Protein (Leu33-Met135), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPREB1 Products
Required fields are marked with *
My Review for All VPREB1 Products
Required fields are marked with *