Recombinant Human VPS53 protein, His-tagged
Cat.No. : | VPS53-2745H |
Product Overview : | Recombinant Human VPS53 protein(1-128 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | September 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-128 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | VPS53 vacuolar protein sorting 53 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VPS53 |
Synonyms | VPS53; vacuolar protein sorting 53 homolog (S. cerevisiae); vacuolar protein sorting 53 (yeast); vacuolar protein sorting-associated protein 53 homolog; FLJ10979; HCCS1; hVps53L; pp13624; FLJ41112; FLJ61757; MGC39512; |
mRNA Refseq | NM_001128159 |
Protein Refseq | NP_001121631 |
UniProt ID | Q5VIR6 |
Gene ID | 55275 |
◆ Recombinant Proteins | ||
VPS53-2034C | Recombinant Chicken VPS53 | +Inquiry |
VPS53-1834Z | Recombinant Zebrafish VPS53 | +Inquiry |
VPS53-3685H | Recombinant Human VPS53, GST-tagged | +Inquiry |
Vps53-6945M | Recombinant Mouse Vps53 Protein, Myc/DDK-tagged | +Inquiry |
VPS53-10076M | Recombinant Mouse VPS53 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS53-1916HCL | Recombinant Human VPS53 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPS53 Products
Required fields are marked with *
My Review for All VPS53 Products
Required fields are marked with *