Recombinant Human VSTM2L, His-tagged
Cat.No. : | VSTM2L-31540TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-204 of Human VSTM2L with N terminal His tag; Predicted MWt 23 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-204 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 138 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGH ALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQW WYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVV KVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARH HKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRK RSVDQEACSL |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain. |
Full Length : | Full L. |
Gene Name | VSTM2L V-set and transmembrane domain containing 2 like [ Homo sapiens ] |
Official Symbol | VSTM2L |
Synonyms | VSTM2L; V-set and transmembrane domain containing 2 like; C20orf102, chromosome 20 open reading frame 102; V-set and transmembrane domain-containing protein 2-like protein; dJ1118M15.2; |
Gene ID | 128434 |
mRNA Refseq | NM_080607 |
Protein Refseq | NP_542174 |
Uniprot ID | Q96N03 |
Chromosome Location | 20q11.23 |
Function | protein binding; |
◆ Recombinant Proteins | ||
VSTM2L-31540TH | Recombinant Human VSTM2L, His-tagged | +Inquiry |
VSTM2L-5179R | Recombinant Rhesus monkey VSTM2L Protein, His-tagged | +Inquiry |
VSTM2L-4833H | Recombinant Human V-Set And Transmembrane Domain Containing 2 Like, His-tagged | +Inquiry |
Vstm2l-6953M | Recombinant Mouse Vstm2l Protein, Myc/DDK-tagged | +Inquiry |
VSTM2L-4691H | Recombinant Human VSTM2L protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSTM2L-376HCL | Recombinant Human VSTM2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VSTM2L Products
Required fields are marked with *
My Review for All VSTM2L Products
Required fields are marked with *
0
Inquiry Basket