Recombinant Human VTCN1 Protein
Cat.No. : | VTCN1-604H |
Product Overview : | Recombinant human VTCN1 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 282 |
Description : | This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | VTCN1 V-set domain containing T cell activation inhibitor 1 [ Homo sapiens (human) ] |
Official Symbol | VTCN1 |
Synonyms | VTCN1; V-set domain containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; B7 family member; H4; B7 superfamily member 1; B7 H4; B7H4; B7S1; B7X; FLJ22418; B7 family member, H4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; immune costimulatory protein B7-H4; B7-H4; B7h.5; VCTN1; PRO1291; RP11-229A19.4; |
Gene ID | 79679 |
mRNA Refseq | NM_001253849 |
Protein Refseq | NP_001240778 |
MIM | 608162 |
UniProt ID | Q7Z7D3 |
◆ Recombinant Proteins | ||
VTCN1-533H | Active Recombinant Mouse VTCN1, MIgG2a Fc-tagged | +Inquiry |
VTCN1-430H | Active Recombinant Human VTCN1 Protein (Phe29-Ala258), HIgG1 Fc-tagged, Biotinylated | +Inquiry |
VTCN1-6550R | Active Recombinant Rat VTCN1 protein, His-tagged | +Inquiry |
VTCN1-3694H | Recombinant Human VTCN1, GST-tagged | +Inquiry |
VTCN1-7299H | Recombinant Human VTCN1 protein (Phe29-Ala258), mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VTCN1-1636MCL | Recombinant Mouse VTCN1 cell lysate | +Inquiry |
VTCN1-1096HCL | Recombinant Human VTCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VTCN1 Products
Required fields are marked with *
My Review for All VTCN1 Products
Required fields are marked with *
0
Inquiry Basket