Recombinant Human VWA5B2 Protein (781-862 aa), His-SUMO-tagged
| Cat.No. : | VWA5B2-1063H |
| Product Overview : | Recombinant Human VWA5B2 Protein (781-862 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 781-862 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 24.6 kDa |
| AA Sequence : | PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | VWA5B2 von Willebrand factor A domain containing 5B2 [ Homo sapiens (human) ] |
| Official Symbol | VWA5B2 |
| Gene ID | 90113 |
| UniProt ID | Q8N398 |
| ◆ Recombinant Proteins | ||
| VWA5B2-18413M | Recombinant Mouse VWA5B2 Protein | +Inquiry |
| VWA5B2-1628H | Recombinant Human VWA5B2 protein, His & T7-tagged | +Inquiry |
| VWA5B2-1063H | Recombinant Human VWA5B2 Protein (781-862 aa), His-SUMO-tagged | +Inquiry |
| VWA5B2-10097M | Recombinant Mouse VWA5B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWA5B2 Products
Required fields are marked with *
My Review for All VWA5B2 Products
Required fields are marked with *



