Recombinant Human WASL, GST-tagged

Cat.No. : WASL-320H
Product Overview : Recombinant Human WASL(1 a.a. - 505 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Wiskott-Aldrich syndrome (WAS) protein family. Wiskott-Aldrich syndrome proteins share similar domain structure, and associate with a variety of signaling molecules to alter the actin cytoskeleton. The encoded protein is highly expressed in neural tissues, and interacts with several proteins involved in cytoskeletal organization, including cell division control protein 42 (CDC42) and the actin-related protein-2/3 (ARP2/3) complex. The encoded protein may be involved in the formation of long actin microspikes, and in neurite extension.
Molecular Mass : 81.2 kDa
AA Sequence : MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRS YFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRD PPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDL NNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPP PPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSV ADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name WASL Wiskott-Aldrich syndrome-like [ Homo sapiens (human) ]
Official Symbol WASL
Synonyms WASL; Wiskott-Aldrich syndrome-like; neural Wiskott-Aldrich syndrome protein; N WASP; NWASP; Wiskott-Aldrich syndrome gene-like; N-WASP; MGC48327; DKFZp779G0847;
Gene ID 8976
mRNA Refseq NM_003941
Protein Refseq NP_003932
MIM 605056
UniProt ID O00401
Chromosome Location 7q31.3
Pathway Adherens junction; CDC42 signaling events; Chemokine signaling pathway
Function actin binding; protein binding; small GTPase regulator activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WASL Products

Required fields are marked with *

My Review for All WASL Products

Required fields are marked with *

0
cart-icon
0
compare icon