Recombinant Human WASL, GST-tagged
Cat.No. : | WASL-320H |
Product Overview : | Recombinant Human WASL(1 a.a. - 505 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Wiskott-Aldrich syndrome (WAS) protein family. Wiskott-Aldrich syndrome proteins share similar domain structure, and associate with a variety of signaling molecules to alter the actin cytoskeleton. The encoded protein is highly expressed in neural tissues, and interacts with several proteins involved in cytoskeletal organization, including cell division control protein 42 (CDC42) and the actin-related protein-2/3 (ARP2/3) complex. The encoded protein may be involved in the formation of long actin microspikes, and in neurite extension. |
Molecular Mass : | 81.2 kDa |
AA Sequence : | MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRS YFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRD PPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDL NNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPP PPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSV ADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | WASL Wiskott-Aldrich syndrome-like [ Homo sapiens (human) ] |
Official Symbol | WASL |
Synonyms | WASL; Wiskott-Aldrich syndrome-like; neural Wiskott-Aldrich syndrome protein; N WASP; NWASP; Wiskott-Aldrich syndrome gene-like; N-WASP; MGC48327; DKFZp779G0847; |
Gene ID | 8976 |
mRNA Refseq | NM_003941 |
Protein Refseq | NP_003932 |
MIM | 605056 |
UniProt ID | O00401 |
Chromosome Location | 7q31.3 |
Pathway | Adherens junction; CDC42 signaling events; Chemokine signaling pathway |
Function | actin binding; protein binding; small GTPase regulator activity |
◆ Recombinant Proteins | ||
WASL-321H | Recombinant Human WASL, MYC/DDK-tagged | +Inquiry |
WASL-5185R | Recombinant Rhesus monkey WASL Protein, His-tagged | +Inquiry |
WASL-4346C | Recombinant Chicken WASL | +Inquiry |
WASL-3699H | Recombinant Human WASL, His-tagged | +Inquiry |
WASL-320H | Recombinant Human WASL, GST-tagged | +Inquiry |
◆ Native Proteins | ||
WASL-001H | Recombinant Human WASL Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WASL-367HCL | Recombinant Human WASL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WASL Products
Required fields are marked with *
My Review for All WASL Products
Required fields are marked with *