Recombinant Human WASL Protein, His tagged

Cat.No. : WASL-001H
Product Overview : Recombinant Human WASL Protein (21-270 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-270 aa
Description : This gene encodes a member of the Wiskott-Aldrich syndrome (WAS) protein family. Wiskott-Aldrich syndrome proteins share similar domain structure, and associate with a variety of signaling molecules to alter the actin cytoskeleton. The encoded protein is highly expressed in neural tissues, and interacts with several proteins involved in cytoskeletal organization, including cell division control protein 42 (CDC42) and the actin-related protein-2/3 (ARP2/3) complex. The encoded protein may be involved in the formation of long actin microspikes, and in neurite extension.
Molecular Mass : 30 kDa
Purity : > 85% by SDS-PAGE
AA Sequence : MLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNHHHHHHHH
Endotoxin : < 1.0 EU/μg by LAL
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol
Concentration : 0.7 mg/mL by BCA
Gene Name WASL WASP like actin nucleation promoting factor [ Homo sapiens (human) ]
Official Symbol WASL
Synonyms WASL; Wiskott-Aldrich syndrome-like; neural Wiskott-Aldrich syndrome protein; N WASP; NWASP; Wiskott-Aldrich syndrome gene-like; N-WASP; MGC48327; DKFZp779G0847
Gene ID 8976
mRNA Refseq NM_003941
Protein Refseq NP_003932
MIM 605056
UniProt ID O00401

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WASL Products

Required fields are marked with *

My Review for All WASL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon