Recombinant Human WDR38 Protein (1-314 aa), GST-tagged
| Cat.No. : | WDR38-2141H |
| Product Overview : | Recombinant Human WDR38 Protein (1-314 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-314 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 61.3 kDa |
| AA Sequence : | MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | WDR38 WD repeat domain 38 [ Homo sapiens (human) ] |
| Official Symbol | WDR38 |
| Synonyms | WDR38; |
| Gene ID | 401551 |
| mRNA Refseq | NM_001045476 |
| Protein Refseq | NP_001038941 |
| UniProt ID | Q5JTN6 |
| ◆ Recombinant Proteins | ||
| WDR38-2141H | Recombinant Human WDR38 Protein (1-314 aa), GST-tagged | +Inquiry |
| WDR38-5011R | Recombinant Rhesus Macaque WDR38 Protein, His (Fc)-Avi-tagged | +Inquiry |
| WDR38-18470M | Recombinant Mouse WDR38 Protein | +Inquiry |
| WDR38-2433Z | Recombinant Zebrafish WDR38 | +Inquiry |
| WDR38-5198R | Recombinant Rhesus monkey WDR38 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WDR38-349HCL | Recombinant Human WDR38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR38 Products
Required fields are marked with *
My Review for All WDR38 Products
Required fields are marked with *
