Recombinant Human WDR38 Protein (1-314 aa), GST-tagged
Cat.No. : | WDR38-2141H |
Product Overview : | Recombinant Human WDR38 Protein (1-314 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-314 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 61.3 kDa |
AA Sequence : | MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | WDR38 WD repeat domain 38 [ Homo sapiens (human) ] |
Official Symbol | WDR38 |
Synonyms | WDR38; |
Gene ID | 401551 |
mRNA Refseq | NM_001045476 |
Protein Refseq | NP_001038941 |
UniProt ID | Q5JTN6 |
◆ Recombinant Proteins | ||
WDR38-5011R | Recombinant Rhesus Macaque WDR38 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR38-10131M | Recombinant Mouse WDR38 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR38-2141H | Recombinant Human WDR38 Protein (1-314 aa), GST-tagged | +Inquiry |
WDR38-18470M | Recombinant Mouse WDR38 Protein | +Inquiry |
WDR38-2433Z | Recombinant Zebrafish WDR38 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR38-349HCL | Recombinant Human WDR38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR38 Products
Required fields are marked with *
My Review for All WDR38 Products
Required fields are marked with *