Recombinant Human WDR38 Protein (1-314 aa), GST-tagged

Cat.No. : WDR38-2141H
Product Overview : Recombinant Human WDR38 Protein (1-314 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-314 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 61.3 kDa
AA Sequence : MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name WDR38 WD repeat domain 38 [ Homo sapiens (human) ]
Official Symbol WDR38
Synonyms WDR38;
Gene ID 401551
mRNA Refseq NM_001045476
Protein Refseq NP_001038941
UniProt ID Q5JTN6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WDR38 Products

Required fields are marked with *

My Review for All WDR38 Products

Required fields are marked with *

0
cart-icon
0
compare icon