Recombinant Human WDR61 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : WDR61-140H
Product Overview : WDR61 MS Standard C13 and N15-labeled recombinant protein (NP_079510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance.
Molecular Mass : 33.6 kDa
AA Sequence : MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name WDR61 WD repeat domain 61 [ Homo sapiens (human) ]
Official Symbol WDR61
Synonyms REC14; SKI8; WD repeat-containing protein 61; SKI8 homolog; meiotic recombination REC14 protein homolog; recombination protein REC14
Gene ID 80349
mRNA Refseq NM_025234
Protein Refseq NP_079510
MIM 609540
UniProt ID Q9GZS3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WDR61 Products

Required fields are marked with *

My Review for All WDR61 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon