Recombinant Human WDR61 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | WDR61-140H |
| Product Overview : | WDR61 MS Standard C13 and N15-labeled recombinant protein (NP_079510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance. |
| Molecular Mass : | 33.6 kDa |
| AA Sequence : | MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | WDR61 WD repeat domain 61 [ Homo sapiens (human) ] |
| Official Symbol | WDR61 |
| Synonyms | REC14; SKI8; WD repeat-containing protein 61; SKI8 homolog; meiotic recombination REC14 protein homolog; recombination protein REC14 |
| Gene ID | 80349 |
| mRNA Refseq | NM_025234 |
| Protein Refseq | NP_079510 |
| MIM | 609540 |
| UniProt ID | Q9GZS3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR61 Products
Required fields are marked with *
My Review for All WDR61 Products
Required fields are marked with *
