Recombinant Human WDR61 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | WDR61-140H |
Product Overview : | WDR61 MS Standard C13 and N15-labeled recombinant protein (NP_079510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance. |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | WDR61 WD repeat domain 61 [ Homo sapiens (human) ] |
Official Symbol | WDR61 |
Synonyms | REC14; SKI8; WD repeat-containing protein 61; SKI8 homolog; meiotic recombination REC14 protein homolog; recombination protein REC14 |
Gene ID | 80349 |
mRNA Refseq | NM_025234 |
Protein Refseq | NP_079510 |
MIM | 609540 |
UniProt ID | Q9GZS3 |
◆ Recombinant Proteins | ||
WDR61-1254C | Recombinant Chicken WDR61 | +Inquiry |
WDR61-3721H | Recombinant Human WDR61, GST-tagged | +Inquiry |
WDR61-5017R | Recombinant Rhesus Macaque WDR61 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR61-11105Z | Recombinant Zebrafish WDR61 | +Inquiry |
WDR61-371H | Recombinant Human WDR61 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR61-339HCL | Recombinant Human WDR61 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR61 Products
Required fields are marked with *
My Review for All WDR61 Products
Required fields are marked with *
0
Inquiry Basket