Recombinant Human WDR92 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: WDR92-2079H
• Product Overview: WDR92 MS Standard C13 and N15-labeled recombinant protein (NP_612467) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein with two WD40 repeat domains thought to be involved in an apoptosis via activation of caspase-3. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 39.7 kDa
• AA Sequence: MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: WDR92 WD repeat domain 92 [ Homo sapiens (human) ]
• Official Symbol: WDR92
• Synonyms: WDR92; WD repeat domain 92; WD repeat-containing protein 92; FLJ31741; Monad; monad; WD repeat-containing protein Monad
• Gene ID: 116143
• mRNA Refseq: NM_138458
• Protein Refseq: NP_612467
• MIM: 610729
• UniProt ID: Q96MX6