Recombinant Human WDR92 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : WDR92-2079H
Product Overview : WDR92 MS Standard C13 and N15-labeled recombinant protein (NP_612467) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein with two WD40 repeat domains thought to be involved in an apoptosis via activation of caspase-3. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 39.7 kDa
AA Sequence : MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name WDR92 WD repeat domain 92 [ Homo sapiens (human) ]
Official Symbol WDR92
Synonyms WDR92; WD repeat domain 92; WD repeat-containing protein 92; FLJ31741; Monad; monad; WD repeat-containing protein Monad;
Gene ID 116143
mRNA Refseq NM_138458
Protein Refseq NP_612467
MIM 610729
UniProt ID Q96MX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WDR92 Products

Required fields are marked with *

My Review for All WDR92 Products

Required fields are marked with *

0
cart-icon
0
compare icon