Recombinant Human WDR92 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | WDR92-2079H |
Product Overview : | WDR92 MS Standard C13 and N15-labeled recombinant protein (NP_612467) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein with two WD40 repeat domains thought to be involved in an apoptosis via activation of caspase-3. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | WDR92 WD repeat domain 92 [ Homo sapiens (human) ] |
Official Symbol | WDR92 |
Synonyms | WDR92; WD repeat domain 92; WD repeat-containing protein 92; FLJ31741; Monad; monad; WD repeat-containing protein Monad; |
Gene ID | 116143 |
mRNA Refseq | NM_138458 |
Protein Refseq | NP_612467 |
MIM | 610729 |
UniProt ID | Q96MX6 |
◆ Recombinant Proteins | ||
WDR92-2079H | Recombinant Human WDR92 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WDR92-10157M | Recombinant Mouse WDR92 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR92-18514M | Recombinant Mouse WDR92 Protein | +Inquiry |
Wdr92-237M | Recombinant Mouse Wdr92 Protein, MYC/DDK-tagged | +Inquiry |
WDR92-5208R | Recombinant Rhesus monkey WDR92 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR92-327HCL | Recombinant Human WDR92 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR92 Products
Required fields are marked with *
My Review for All WDR92 Products
Required fields are marked with *
0
Inquiry Basket