Recombinant Human WDYHV1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : WDYHV1-3724H
Product Overview : WDYHV1 MS Standard C13 and N15-labeled recombinant protein (NP_060494) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NTAQ1 (N-Terminal Glutamine Amidase 1) is a Protein Coding gene.
Molecular Mass : 23.6 kDa
AA Sequence : MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name WDYHV1 WDYHV motif containing 1 [ Homo sapiens (human) ]
Official Symbol WDYHV1
Synonyms WDYHV1; WDYHV motif containing 1; C8orf32, chromosome 8 open reading frame 32; protein N-terminal glutamine amidohydrolase; FLJ10204; nt(Q)-amidase; N-terminal Gln amidase; WDYHV motif-containing protein 1; protein NH2-terminal glutamine deamidase; C8orf32;
Gene ID 55093
mRNA Refseq NM_018024
Protein Refseq NP_060494
UniProt ID Q96HA8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WDYHV1 Products

Required fields are marked with *

My Review for All WDYHV1 Products

Required fields are marked with *

0
cart-icon
0
compare icon