Recombinant Human WDYHV1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: WDYHV1-3724H
• Product Overview: WDYHV1 MS Standard C13 and N15-labeled recombinant protein (NP_060494) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NTAQ1 (N-Terminal Glutamine Amidase 1) is a Protein Coding gene.
• Molecular Mass: 23.6 kDa
• AA Sequence: MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: WDYHV1 WDYHV motif containing 1 [ Homo sapiens (human) ]
• Official Symbol: WDYHV1
• Synonyms: WDYHV1; WDYHV motif containing 1; C8orf32, chromosome 8 open reading frame 32; protein N-terminal glutamine amidohydrolase; FLJ10204; nt(Q)-amidase; N-terminal Gln amidase; WDYHV motif-containing protein 1; protein NH2-terminal glutamine deamidase; C8orf32
• Gene ID: 55093
• mRNA Refseq: NM_018024
• Protein Refseq: NP_060494
• UniProt ID: Q96HA8