Recombinant Human WDYHV1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | WDYHV1-3724H |
Product Overview : | WDYHV1 MS Standard C13 and N15-labeled recombinant protein (NP_060494) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NTAQ1 (N-Terminal Glutamine Amidase 1) is a Protein Coding gene. |
Molecular Mass : | 23.6 kDa |
AA Sequence : | MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | WDYHV1 WDYHV motif containing 1 [ Homo sapiens (human) ] |
Official Symbol | WDYHV1 |
Synonyms | WDYHV1; WDYHV motif containing 1; C8orf32, chromosome 8 open reading frame 32; protein N-terminal glutamine amidohydrolase; FLJ10204; nt(Q)-amidase; N-terminal Gln amidase; WDYHV motif-containing protein 1; protein NH2-terminal glutamine deamidase; C8orf32; |
Gene ID | 55093 |
mRNA Refseq | NM_018024 |
Protein Refseq | NP_060494 |
UniProt ID | Q96HA8 |
◆ Recombinant Proteins | ||
Wdyhv1-6991M | Recombinant Mouse Wdyhv1 Protein, Myc/DDK-tagged | +Inquiry |
WDYHV1-10159M | Recombinant Mouse WDYHV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDYHV1-18520M | Recombinant Mouse WDYHV1 Protein | +Inquiry |
WDYHV1-5023R | Recombinant Rhesus Macaque WDYHV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDYHV1-4045Z | Recombinant Zebrafish WDYHV1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDYHV1-324HCL | Recombinant Human WDYHV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDYHV1 Products
Required fields are marked with *
My Review for All WDYHV1 Products
Required fields are marked with *
0
Inquiry Basket