Recombinant Human WDYHV1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | WDYHV1-3724H |
| Product Overview : | WDYHV1 MS Standard C13 and N15-labeled recombinant protein (NP_060494) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | NTAQ1 (N-Terminal Glutamine Amidase 1) is a Protein Coding gene. |
| Molecular Mass : | 23.6 kDa |
| AA Sequence : | MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | WDYHV1 WDYHV motif containing 1 [ Homo sapiens (human) ] |
| Official Symbol | WDYHV1 |
| Synonyms | WDYHV1; WDYHV motif containing 1; C8orf32, chromosome 8 open reading frame 32; protein N-terminal glutamine amidohydrolase; FLJ10204; nt(Q)-amidase; N-terminal Gln amidase; WDYHV motif-containing protein 1; protein NH2-terminal glutamine deamidase; C8orf32; |
| Gene ID | 55093 |
| mRNA Refseq | NM_018024 |
| Protein Refseq | NP_060494 |
| UniProt ID | Q96HA8 |
| ◆ Recombinant Proteins | ||
| WDYHV1-4045Z | Recombinant Zebrafish WDYHV1 | +Inquiry |
| WDYHV1-6239R | Recombinant Rat WDYHV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| WDYHV1-18520M | Recombinant Mouse WDYHV1 Protein | +Inquiry |
| WDYHV1-6583R | Recombinant Rat WDYHV1 Protein | +Inquiry |
| WDYHV1-3725H | Recombinant Human WDYHV1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WDYHV1-324HCL | Recombinant Human WDYHV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDYHV1 Products
Required fields are marked with *
My Review for All WDYHV1 Products
Required fields are marked with *
