Recombinant Human WFDC2 protein, GST-tagged
Cat.No. : | WFDC2-6743H |
Product Overview : | Recombinant Human WFDC2 protein(21-124 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 21-124 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | WFDC2 WAP four-disulfide core domain 2 [ Homo sapiens ] |
Official Symbol | WFDC2 |
Synonyms | WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529; |
Gene ID | 10406 |
mRNA Refseq | NM_006103 |
Protein Refseq | NP_006094 |
UniProt ID | Q14508 |
◆ Recombinant Proteins | ||
WFDC2-6243R | Recombinant Rat WFDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
WFDC2-916C | Recombinant Canine WFDC2 Protein (Met1-Phe124), HlgG1 Fc-tagged | +Inquiry |
WFDC2-3983H | Recombinant Human WFDC2 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
Wfdc2-894M | Recombinant Mouse Wfdc2 Protein, His-tagged | +Inquiry |
WFDC2-5532H | Recombinant Human WFDC2 Protein (Glu31-Phe124), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC2-2056HCL | Recombinant Human WFDC2 cell lysate | +Inquiry |
WFDC2-1266CCL | Recombinant Canine WFDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WFDC2 Products
Required fields are marked with *
My Review for All WFDC2 Products
Required fields are marked with *