Recombinant Human WIF1 protein
| Cat.No. : | WIF1-577H |
| Product Overview : | Recombinant Human Wnt Inhibitory Factor 1 is produced by our Mammalian expression system and the target gene encoding Gly29-Trp379 is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Non |
| Protein Length : | 29-379 a.a. |
| Description : | WIF (Wnt Inhibitory Factor) is a secreted protein that binds to Wnt proteins and inhibits their activity. The protein is synthesized as a 379 amino acid (AA) molecule that contains an N-terminal signal sequence, 150 AA WIF domain, 5 EGF-like repeats, and a hydrophilic domain at the carboxy terminus. In situ hybridization analysis from the frog, Xenopus laevis, and zebrafish indicate that the message is highly expressed in presomitic mesoderm, the notochord, anterior regions of the brain, branchial arches, nasal placodes, and otic vescicles. WIF inhibits secondary axis induction by Wnts and promotes secondary axis induction by Chordin in Xenopus embryos. In vitro, WIF binds to Drosophila Wingless and Xenopus Wnt8 proteins. WIF-1 is implicated as an early event tumor suppressor in cancers of the prostate, breast, lung and bladder. However, WIF-1’s role in carcinogenesis may not be that simple since in other cancer types, such as colon adenocarcinoma, WIF facilitates tumorigenesis. Human WIF-1 shares 94% and 82% amino acid identity with mouse and frog, respectively. |
| Form : | Lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.5% CHAPS, pH 4.0. |
| AA Sequence : | GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIWVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Reconstitution : | It is not recommended to reconstitute to a concentration less than 100 μg/ml |
| Gene Name | WIF1 WNT inhibitory factor 1 [ Homo sapiens ] |
| Official Symbol | WIF1 |
| Synonyms | WIF1; WNT inhibitory factor 1; wnt inhibitory factor 1; WIF-1 |
| Gene ID | 11197 |
| mRNA Refseq | NM_007191 |
| Protein Refseq | NP_009122 |
| MIM | 605186 |
| UniProt ID | Q9Y5W5 |
| ◆ Recombinant Proteins | ||
| WIF1-268H | Active Recombinant Human WIF1 protein, His-tagged | +Inquiry |
| WIF1-3730H | Recombinant Human WIF1, His-tagged | +Inquiry |
| WIF1-4419C | Recombinant Chicken WIF1 | +Inquiry |
| Wif1-1895R | Recombinant Rat Wif1 protein, His & T7-tagged | +Inquiry |
| WIF1-6246R | Recombinant Rat WIF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WIF1-1525MCL | Recombinant Mouse WIF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WIF1 Products
Required fields are marked with *
My Review for All WIF1 Products
Required fields are marked with *
