Recombinant Human WNT10A protein, GST-tagged
Cat.No. : | WNT10A-301293H |
Product Overview : | Recombinant Human WNT10A (154-229 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu152-Leu229 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | WNT10A wingless-type MMTV integration site family, member 10A [ Homo sapiens ] |
Official Symbol | WNT10A |
Synonyms | WNT10A; wingless-type MMTV integration site family, member 10A; |
Gene ID | 93651 |
◆ Recombinant Proteins | ||
WNT10A-1721H | Recombinant Human WNT10A Protein (36-417 aa), His-tagged | +Inquiry |
WNT10A-10191M | Recombinant Mouse WNT10A Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT10A-111H | Recombinant Human WNT10A Protein | +Inquiry |
WNT10A-582H | Recombinant Human WNT10A Protein, His&GST-tagged | +Inquiry |
WNT10A-18564M | Recombinant Mouse WNT10A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT10A-303HCL | Recombinant Human WNT10A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT10A Products
Required fields are marked with *
My Review for All WNT10A Products
Required fields are marked with *