Recombinant Human WNT4 protein, His-tagged
| Cat.No. : | WNT4-5322H |
| Product Overview : | Recombinant Human WNT4 protein(1-70 aa ), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-70 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRG |
| Gene Name | WNT4 wingless-type MMTV integration site family, member 4 [ Homo sapiens ] |
| Official Symbol | WNT4 |
| Synonyms | WNT4; wingless-type MMTV integration site family, member 4; protein Wnt-4; WNT 4; WNT-4; SERKAL; |
| Gene ID | 54361 |
| mRNA Refseq | NM_030761 |
| Protein Refseq | NP_110388 |
| MIM | 603490 |
| UniProt ID | P56705 |
| ◆ Recombinant Proteins | ||
| WNT4-517HFL | Recombinant Full Length Human WNT4 Protein, N-Fc-Flag-tagged | +Inquiry |
| WNT4-6599R | Recombinant Rat WNT4 Protein | +Inquiry |
| WNT4-6347C | Recombinant Chicken WNT4 | +Inquiry |
| WNT4-01H | Recombinant Human WNT4 Protein, His-tagged | +Inquiry |
| Wnt4-622M | Active Recombinant Mouse Wnt4 | +Inquiry |
| ◆ Native Proteins | ||
| Wnt4-623M | Active Recombinant Mouse Wnt4 Protein, Fc tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WNT4-294HCL | Recombinant Human WNT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT4 Products
Required fields are marked with *
My Review for All WNT4 Products
Required fields are marked with *
