Recombinant Human WNT4 protein, His-tagged
Cat.No. : | WNT4-5322H |
Product Overview : | Recombinant Human WNT4 protein(1-70 aa ), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-70 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRG |
Gene Name | WNT4 wingless-type MMTV integration site family, member 4 [ Homo sapiens ] |
Official Symbol | WNT4 |
Synonyms | WNT4; wingless-type MMTV integration site family, member 4; protein Wnt-4; WNT 4; WNT-4; SERKAL; |
Gene ID | 54361 |
mRNA Refseq | NM_030761 |
Protein Refseq | NP_110388 |
MIM | 603490 |
UniProt ID | P56705 |
◆ Recombinant Proteins | ||
WNT4-1852M | Recombinant Mouse WNT4 protein(23-351aa), His-tagged | +Inquiry |
WNT4-5322H | Recombinant Human WNT4 protein, His-tagged | +Inquiry |
WNT4-3740H | Recombinant Human WNT4, His-tagged | +Inquiry |
WNT4-1891H | Recombinant Human WNT4 protein, His-tagged | +Inquiry |
WNT4-117H | Active Recombinant Human WNT4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT4-294HCL | Recombinant Human WNT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT4 Products
Required fields are marked with *
My Review for All WNT4 Products
Required fields are marked with *
0
Inquiry Basket