Recombinant Human WTAP protein, GST-tagged

• Cat.No.: WTAP-3744H
• Product Overview: Recombinant Human WTAP protein(2-150 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 2-150 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: WTAP Wilms tumor 1 associated protein [ Homo sapiens ]
• Official Symbol: WTAP
• Synonyms: WTAP; Wilms tumor 1 associated protein; pre-mRNA-splicing regulator WTAP; KIAA0105; MGC3925; hFL(2)D; PNAS-132; WT1-associated protein; female-lethal(2)D homolog; wilms tumor 1-associating protein; Wilms tumour 1-associating protein; putative pre-mRNA splicing regulator female-lethal(2D); DKFZp686F20131
• Gene ID: 9589
• mRNA Refseq: NM_004906
• Protein Refseq: NP_004897
• MIM: 605442
• UniProt ID: Q15007