Recombinant Human WWOX protein, His-tagged
Cat.No. : | WWOX-3909H |
Product Overview : | Recombinant Human WWOX protein(1-234 aa), fused to His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-234 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | WWOX WW domain containing oxidoreductase [ Homo sapiens ] |
Official Symbol | WWOX |
Synonyms | WWOX; WW domain containing oxidoreductase; WW domain-containing oxidoreductase; FOR; SDR41C1; short chain dehydrogenase/reductase family 41C; member 1; WOX1; WW domain-containing protein WWOX; fragile site FRA16D oxidoreductase; short chain dehydrogenase/reductase family 41C, member 1; FRA16D; HHCMA56; PRO0128; D16S432E; |
Gene ID | 51741 |
mRNA Refseq | NM_016373 |
Protein Refseq | NP_057457 |
MIM | 605131 |
UniProt ID | Q9NZC7 |
◆ Recombinant Proteins | ||
WWOX-3746H | Recombinant Human WWOX protein, GST-tagged | +Inquiry |
WWOX-31530TH | Recombinant Human WWOX, His-tagged | +Inquiry |
WWOX-6922H | Recombinant Human WW Domain Containing Oxidoreductase, His-tagged | +Inquiry |
WWOX-4242H | Recombinant Human WWOX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WWOX-3909H | Recombinant Human WWOX protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WWOX-274HCL | Recombinant Human WWOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WWOX Products
Required fields are marked with *
My Review for All WWOX Products
Required fields are marked with *