Recombinant Human WWP2 protein, His-tagged
| Cat.No. : | WWP2-3842H |
| Product Overview : | Recombinant Human WWP2 protein(1-355 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-355 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | WWP2 WW domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ] |
| Official Symbol | WWP2 |
| Synonyms | WWP2; WW domain containing E3 ubiquitin protein ligase 2; NEDD4-like E3 ubiquitin-protein ligase WWP2; AIP2; WW domain-containing protein 2; atrophin-1 interacting protein 2; atrophin-1-interacting protein 2; Nedd-4-like ubiquitin-protein ligase; WWp2-like; |
| Gene ID | 11060 |
| mRNA Refseq | NM_007014 |
| Protein Refseq | NP_008945 |
| MIM | 602308 |
| UniProt ID | O00308 |
| ◆ Recombinant Proteins | ||
| WWP2-652H | Active Recombinant Human WWP2 Protein, GST-tagged | +Inquiry |
| WWP2-0442H | Recombinant Human WWP2 Protein (A2-E870), Tag Free | +Inquiry |
| WWP2-0443H | Recombinant Human WWP2 Protein (A2-E870), His tagged | +Inquiry |
| WWP2-376H | Recombinant Human WWP2 Protein, MYC/DDK-tagged | +Inquiry |
| WWP2-240H | Recombinant Human WWP2, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WWP2-001HCL | Recombinant Human WWP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WWP2 Products
Required fields are marked with *
My Review for All WWP2 Products
Required fields are marked with *
