Recombinant Human XAB2 protein, GST-tagged

Cat.No. : XAB2-23H
Product Overview : Recombinant Human GST(530 - 855 aa ) fused with GST tag was expressed in E. coli.
Availability December 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 530-855 a.a.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
AA Sequence : EHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage : Short-term storage: Store at 2-8 centigrade for two weeks.
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name XAB2 XPA binding protein 2 [ Homo sapiens ]
Official Symbol XAB2
Synonyms XAB2; XPA binding protein 2; pre-mRNA-splicing factor SYF1; HCNP; HCRN; NTC90; SYF1; SYF1 homolog; RNA splicing factor (S. cerevisiae); XPA-binding protein 2; crn-related protein kim1; SYF1 homolog, RNA splicing factor; DKFZp762C1015;
Gene ID 56949
mRNA Refseq NM_020196
Protein Refseq NP_064581
MIM 610850
UniProt ID Q9HCS7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XAB2 Products

Required fields are marked with *

My Review for All XAB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon