Recombinant Human XAB2 protein, GST-tagged
Cat.No. : | XAB2-23H |
Product Overview : | Recombinant Human GST(530 - 855 aa ) fused with GST tag was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 530-855 a.a. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
AA Sequence : | EHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigrade for two weeks. Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | XAB2 XPA binding protein 2 [ Homo sapiens ] |
Official Symbol | XAB2 |
Synonyms | XAB2; XPA binding protein 2; pre-mRNA-splicing factor SYF1; HCNP; HCRN; NTC90; SYF1; SYF1 homolog; RNA splicing factor (S. cerevisiae); XPA-binding protein 2; crn-related protein kim1; SYF1 homolog, RNA splicing factor; DKFZp762C1015; |
Gene ID | 56949 |
mRNA Refseq | NM_020196 |
Protein Refseq | NP_064581 |
MIM | 610850 |
UniProt ID | Q9HCS7 |
◆ Recombinant Proteins | ||
XAB2-23H | Recombinant Human XAB2 protein, GST-tagged | +Inquiry |
XAB2-3926Z | Recombinant Zebrafish XAB2 | +Inquiry |
XAB2-6606R | Recombinant Rat XAB2 Protein | +Inquiry |
XAB2-10218M | Recombinant Mouse XAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
XAB2-6262R | Recombinant Rat XAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XAB2-1935HCL | Recombinant Human XAB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XAB2 Products
Required fields are marked with *
My Review for All XAB2 Products
Required fields are marked with *