Recombinant Human XAF1 protein, GST-tagged
| Cat.No. : | XAF1-6744H |
| Product Overview : | Recombinant Human XAF1 protein(254-301 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 254-301 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | XAF1 XIAP associated factor 1 [ Homo sapiens ] |
| Official Symbol | XAF1 |
| Synonyms | XAF1; XIAP associated factor 1; XIAP-associated factor 1; BIRC4BP; HSXIAPAF1; XIAPAF1; BIRC4 binding protein; BIRC4-binding protein; |
| Gene ID | 54739 |
| mRNA Refseq | NM_017523 |
| Protein Refseq | NP_059993 |
| MIM | 606717 |
| UniProt ID | Q6GPH4 |
| ◆ Recombinant Proteins | ||
| XAF1-5226R | Recombinant Rhesus monkey XAF1 Protein, His-tagged | +Inquiry |
| XAF1-185H | Recombinant Human XAF1, His-tagged | +Inquiry |
| XAF1-5039R | Recombinant Rhesus Macaque XAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| XAF1-10219M | Recombinant Mouse XAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| XAF1-18600M | Recombinant Mouse XAF1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| XAF1-271HCL | Recombinant Human XAF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XAF1 Products
Required fields are marked with *
My Review for All XAF1 Products
Required fields are marked with *
