Recombinant Human XAGE2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | XAGE2-1813H |
| Product Overview : | XAGE2 MS Standard C13 and N15-labeled recombinant protein (NP_570133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. |
| Molecular Mass : | 12.4 kDa |
| AA Sequence : | MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | XAGE2 X antigen family member 2 [ Homo sapiens (human) ] |
| Official Symbol | XAGE2 |
| Synonyms | XAGE2; X antigen family, member 2; G antigen, family D, 3, GAGED3; G antigen family D member 3; cancer/testis antigen family 12; member 2; CT12.2; XAGE 2; protein XAGE-2; G antigen, family D, 3; cancer/testis antigen 12.2; cancer/testis antigen family 12, member 2; GAGED3; XAGE-2; XAGE2B; |
| Gene ID | 9502 |
| mRNA Refseq | NM_130777 |
| Protein Refseq | NP_570133 |
| MIM | 300416 |
| UniProt ID | Q96GT9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XAGE2 Products
Required fields are marked with *
My Review for All XAGE2 Products
Required fields are marked with *



