Recombinant Human XBP1 protein, His-tagged
Cat.No. : | XBP1-1571H |
Product Overview : | Recombinant Human XBP1 protein(167-261 aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 167-261 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | XBP1 X-box binding protein 1 [ Homo sapiens ] |
Official Symbol | XBP1 |
Synonyms | XBP1; X-box binding protein 1; XBP2; X-box-binding protein 1; tax-responsive element-binding protein 5; TREB5; XBP-1 |
Gene ID | 7494 |
mRNA Refseq | NM_001079539 |
Protein Refseq | NP_001073007 |
MIM | 194355 |
UniProt ID | P17861 |
◆ Recombinant Proteins | ||
XBP1-6263R | Recombinant Rat XBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
XBP1-18601M | Recombinant Mouse XBP1 Protein | +Inquiry |
XBP1-9378Z | Recombinant Zebrafish XBP1 | +Inquiry |
XBP1-1341C | Recombinant Chicken XBP1 | +Inquiry |
XBP1-5227R | Recombinant Rhesus monkey XBP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XBP1-267HCL | Recombinant Human XBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XBP1 Products
Required fields are marked with *
My Review for All XBP1 Products
Required fields are marked with *
0
Inquiry Basket