Recombinant Human XBP1 protein, His-tagged

• Cat.No.: XBP1-1571H
• Product Overview: Recombinant Human XBP1 protein(167-261 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 167-261 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: XBP1 X-box binding protein 1 [ Homo sapiens ]
• Official Symbol: XBP1
• Synonyms: XBP1; X-box binding protein 1; XBP2; X-box-binding protein 1; tax-responsive element-binding protein 5; TREB5; XBP-1
• Gene ID: 7494
• mRNA Refseq: NM_001079539
• Protein Refseq: NP_001073007
• MIM: 194355
• UniProt ID: P17861