Recombinant Human XPNPEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : XPNPEP1-5522H
Product Overview : XPNPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_065116) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants.
Molecular Mass : 69.9 kDa
AA Sequence : MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name XPNPEP1 X-prolyl aminopeptidase 1 [ Homo sapiens (human) ]
Official Symbol XPNPEP1
Synonyms XPNPEP1; X-prolyl aminopeptidase (aminopeptidase P) 1, soluble; X prolyl aminopeptidase (aminopeptidase P) like, XPNPEP, XPNPEPL, XPNPEPL1; xaa-Pro aminopeptidase 1; X-Pro aminopeptidase 1; soluble aminopeptidase P; cytosolic aminopeptidase P; aminopeptidase P, cytosolic; aminoacylproline aminopeptidase; X-prolyl aminopeptidase 1, soluble; APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1;
Gene ID 7511
mRNA Refseq NM_020383
Protein Refseq NP_065116
MIM 602443
UniProt ID Q9NQW7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XPNPEP1 Products

Required fields are marked with *

My Review for All XPNPEP1 Products

Required fields are marked with *

0
cart-icon