Recombinant Human XPNPEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | XPNPEP1-5522H |
Product Overview : | XPNPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_065116) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 69.9 kDa |
AA Sequence : | MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | XPNPEP1 X-prolyl aminopeptidase 1 [ Homo sapiens (human) ] |
Official Symbol | XPNPEP1 |
Synonyms | XPNPEP1; X-prolyl aminopeptidase (aminopeptidase P) 1, soluble; X prolyl aminopeptidase (aminopeptidase P) like, XPNPEP, XPNPEPL, XPNPEPL1; xaa-Pro aminopeptidase 1; X-Pro aminopeptidase 1; soluble aminopeptidase P; cytosolic aminopeptidase P; aminopeptidase P, cytosolic; aminoacylproline aminopeptidase; X-prolyl aminopeptidase 1, soluble; APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1; |
Gene ID | 7511 |
mRNA Refseq | NM_020383 |
Protein Refseq | NP_065116 |
MIM | 602443 |
UniProt ID | Q9NQW7 |
◆ Recombinant Proteins | ||
XPNPEP1-5522H | Recombinant Human XPNPEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Xpnpep1-7018M | Recombinant Full Length Mouse Xpnpep1 Protein, Flag tagged | +Inquiry |
XPNPEP1-87H | Recombinant Human XPNPEP1, His-tagged | +Inquiry |
XPNPEP1-12227Z | Recombinant Zebrafish XPNPEP1 | +Inquiry |
XPNPEP1-2955H | Recombinant Human XPNPEP1, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XPNPEP1-261HCL | Recombinant Human XPNPEP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XPNPEP1 Products
Required fields are marked with *
My Review for All XPNPEP1 Products
Required fields are marked with *