Recombinant Human XPNPEP3 Protein, His-tagged
Cat.No. : | XPNPEP3-414H |
Product Overview : | Recombinant Human XPNPEP3, transcript variant 1, fused with His tag at N, C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known. |
Form : | Supplied as a 0.2 µM filtered solution of 25mM Tris, 1mM DTT, pH 7.3 |
Molecular Mass : | 60.2kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRG |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | XPNPEP3 X-prolyl aminopeptidase (aminopeptidase P) 3, putative [ Homo sapiens ] |
Official Symbol | XPNPEP3 |
Synonyms | XPNPEP3; X-prolyl aminopeptidase (aminopeptidase P) 3, putative; probable Xaa-Pro aminopeptidase 3; APP3; NPHPL1; X-Pro aminopeptidase 3; |
Gene ID | 63929 |
mRNA Refseq | NM_001204827 |
Protein Refseq | NP_001191756 |
MIM | 613553 |
UniProt ID | Q9NQH7 |
◆ Recombinant Proteins | ||
XPNPEP3-1962H | Recombinant Human XPNPEP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
XPNPEP3-6257H | Recombinant Human XPNPEP3 Protein (Glu253-Gln482), N-His tagged | +Inquiry |
XPNPEP3-6274R | Recombinant Rat XPNPEP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
XPNPEP3-3510H | Recombinant Human XPNPEP3 protein, His-tagged | +Inquiry |
Xpnpep3-7020M | Recombinant Mouse Xpnpep3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XPNPEP3-260HCL | Recombinant Human XPNPEP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XPNPEP3 Products
Required fields are marked with *
My Review for All XPNPEP3 Products
Required fields are marked with *
0
Inquiry Basket