Recombinant Human XPO5 protein, His-tagged
| Cat.No. : | XPO5-2819H |
| Product Overview : | Recombinant Human XPO5 protein(1-100 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 20, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-100 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | XPO5 exportin 5 [ Homo sapiens ] |
| Official Symbol | XPO5 |
| Synonyms | XPO5; exportin 5; exportin-5; KIAA1291; ran-binding protein 21; exp5; FLJ14239; FLJ32057; FLJ45606; |
| Gene ID | 57510 |
| mRNA Refseq | NM_020750 |
| Protein Refseq | NP_065801 |
| MIM | 607845 |
| UniProt ID | Q9HAV4 |
| ◆ Recombinant Proteins | ||
| XPO5-1404H | Recombinant Human XPO5 protein, His & T7-tagged | +Inquiry |
| XPO5-5030C | Recombinant Chicken XPO5 | +Inquiry |
| XPO5-5765H | Recombinant Human XPO5 protein, GST-tagged | +Inquiry |
| XPO5-2368H | Recombinant Human XPO5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| XPO5-5044R | Recombinant Rhesus Macaque XPO5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| XPO5-1938HCL | Recombinant Human XPO5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XPO5 Products
Required fields are marked with *
My Review for All XPO5 Products
Required fields are marked with *
