Recombinant Human XRCC5 protein(571-730 aa), C-His-tagged
| Cat.No. : | XRCC5-2646H |
| Product Overview : | Recombinant Human XRCC5 protein(P13010)(571-730 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 571-730 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 19.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLD |
| Gene Name | XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ] |
| Official Symbol | XRCC5 |
| Synonyms | XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross-complementing protein 5; KARP 1; Ku autoantigen; 80kDa; KU80; Ku86; KUB2; TLAA; CTC85; CTCBF; nuclear factor IV; Ku autoantigen, 80kDa; DNA repair protein XRCC5; thyroid-lupus autoantigen; 86 kDa subunit of Ku antigen; lupus Ku autoantigen protein p86; Ku86 autoantigen related protein 1; CTC box-binding factor 85 kDa subunit; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; NFIV; KARP1; KARP-1; FLJ39089; |
| Gene ID | 7520 |
| mRNA Refseq | NM_021141 |
| Protein Refseq | NP_066964 |
| MIM | 194364 |
| UniProt ID | P13010 |
| ◆ Recombinant Proteins | ||
| XRCC5-18639M | Recombinant Mouse XRCC5 Protein | +Inquiry |
| XRCC5-3556H | Recombinant Human XRCC5 protein, His-tagged | +Inquiry |
| Xrcc5-8229M | Recombinant Mouse Xrcc5 protein, His & T7-tagged | +Inquiry |
| XRCC5-5233R | Recombinant Rhesus monkey XRCC5 Protein, His-tagged | +Inquiry |
| XRCC5-3774H | Recombinant Human XRCC5 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| XRCC5-254HCL | Recombinant Human XRCC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XRCC5 Products
Required fields are marked with *
My Review for All XRCC5 Products
Required fields are marked with *
