Recombinant Human XRCC6, His-tagged
Cat.No. : | XRCC6-29198TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 334-609 of Human Ku70 with N terminal His tag; 276 amino acids, 36kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 334-609 a.a. |
Description : | The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEES LVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFV ALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEK IMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRN LEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKE LVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTH ISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTK HFQD |
Sequence Similarities : | Belongs to the ku70 family.Contains 1 Ku domain.Contains 1 SAP domain. |
Gene Name | XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 [ Homo sapiens ] |
Official Symbol | XRCC6 |
Synonyms | XRCC6; X-ray repair complementing defective repair in Chinese hamster cells 6; G22P1, thyroid autoantigen 70kD (Ku antigen) , thyroid autoantigen 70kDa (Ku antigen); X-ray repair cross-complementing protein 6; D22S671; D22S731; Ku autoantigen; 70kDa; KU |
Gene ID | 2547 |
mRNA Refseq | NM_001469 |
Protein Refseq | NP_001460 |
MIM | 152690 |
Uniprot ID | P12956 |
Chromosome Location | 22q13.2 |
Pathway | 2-LTR circle formation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA-PK complex, organism-specific biosystem; |
Function | 5-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; double-stranded DNA binding; |
◆ Recombinant Proteins | ||
XRCC6-1548H | Recombinant Human XRCC6 protein | +Inquiry |
XRCC6-5925H | Recombinant Human XRCC6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Xrcc6-448M | Recombinant Mouse Xrcc6 Protein, His-tagged | +Inquiry |
XRCC6-29198TH | Recombinant Human XRCC6, His-tagged | +Inquiry |
XRCC6-6488C | Recombinant Chicken XRCC6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRCC6-253HCL | Recombinant Human XRCC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XRCC6 Products
Required fields are marked with *
My Review for All XRCC6 Products
Required fields are marked with *