Recombinant Human XRCC6, His-tagged

Cat.No. : XRCC6-29198TH
Product Overview : Recombinant fragment, corresponding to amino acids 334-609 of Human Ku70 with N terminal His tag; 276 amino acids, 36kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 334-609 a.a.
Description : The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 69 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEES LVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFV ALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEK IMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRN LEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKE LVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTH ISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTK HFQD
Sequence Similarities : Belongs to the ku70 family.Contains 1 Ku domain.Contains 1 SAP domain.
Gene Name XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 [ Homo sapiens ]
Official Symbol XRCC6
Synonyms XRCC6; X-ray repair complementing defective repair in Chinese hamster cells 6; G22P1, thyroid autoantigen 70kD (Ku antigen) , thyroid autoantigen 70kDa (Ku antigen); X-ray repair cross-complementing protein 6; D22S671; D22S731; Ku autoantigen; 70kDa; KU
Gene ID 2547
mRNA Refseq NM_001469
Protein Refseq NP_001460
MIM 152690
Uniprot ID P12956
Chromosome Location 22q13.2
Pathway 2-LTR circle formation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA-PK complex, organism-specific biosystem;
Function 5-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; double-stranded DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XRCC6 Products

Required fields are marked with *

My Review for All XRCC6 Products

Required fields are marked with *

0
cart-icon