Recombinant Human YAF2 protein, His-tagged
Cat.No. : | YAF2-3760H |
Product Overview : | Recombinant Human YAF2 protein(1-204 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-204 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | YAF2 YY1 associated factor 2 [ Homo sapiens ] |
Official Symbol | YAF2 |
Synonyms | YAF2; YY1 associated factor 2; YY1-associated factor 2; MGC41856; DKFZp779H1820; |
Gene ID | 10138 |
mRNA Refseq | NM_001190977 |
Protein Refseq | NP_001177906 |
MIM | 607534 |
UniProt ID | Q8IY57 |
◆ Recombinant Proteins | ||
YAF2-3760H | Recombinant Human YAF2 protein, His-tagged | +Inquiry |
YAF2-1775C | Recombinant Chicken YAF2 | +Inquiry |
YAF2-5234R | Recombinant Rhesus monkey YAF2 Protein, His-tagged | +Inquiry |
YAF2-18647M | Recombinant Mouse YAF2 Protein | +Inquiry |
YAF2-4267Z | Recombinant Zebrafish YAF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
YAF2-1943HCL | Recombinant Human YAF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YAF2 Products
Required fields are marked with *
My Review for All YAF2 Products
Required fields are marked with *