Recombinant Human YAF2 protein, His-tagged
| Cat.No. : | YAF2-3760H |
| Product Overview : | Recombinant Human YAF2 protein(1-204 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | June 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-204 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | YAF2 YY1 associated factor 2 [ Homo sapiens ] |
| Official Symbol | YAF2 |
| Synonyms | YAF2; YY1 associated factor 2; YY1-associated factor 2; MGC41856; DKFZp779H1820; |
| Gene ID | 10138 |
| mRNA Refseq | NM_001190977 |
| Protein Refseq | NP_001177906 |
| MIM | 607534 |
| UniProt ID | Q8IY57 |
| ◆ Recombinant Proteins | ||
| YAF2-10246M | Recombinant Mouse YAF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| YAF2-1775C | Recombinant Chicken YAF2 | +Inquiry |
| YAF2-4353H | Recombinant Human YAF2 protein, GST-tagged | +Inquiry |
| Yaf2-7026M | Recombinant Mouse Yaf2 Protein, Myc/DDK-tagged | +Inquiry |
| Yaf2-7940R | Recombinant Rat Yaf2 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YAF2-1943HCL | Recombinant Human YAF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YAF2 Products
Required fields are marked with *
My Review for All YAF2 Products
Required fields are marked with *
