Recombinant Human YARS protein, GST-tagged
Cat.No. : | YARS-3776H |
Product Overview : | Recombinant Human YARS protein(P54577)(2-528aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-528aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 86 kDa |
AA Sequence : | GDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | YARS tyrosyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | YARS |
Synonyms | YARS; tyrosyl-tRNA synthetase; tyrosine--tRNA ligase, cytoplasmic; tyrosine tRNA ligase 1; cytoplasmic; tyrRS; YRS; YTS; tyrosyl--tRNA ligase; tyrosine tRNA ligase 1, cytoplasmic; tyrosyl-tRNA synthetase, cytoplasmic; TYRRS; CMTDIC; |
Gene ID | 8565 |
mRNA Refseq | NM_003680 |
Protein Refseq | NP_003671 |
MIM | 603623 |
UniProt ID | P54577 |
◆ Recombinant Proteins | ||
YARS-18649M | Recombinant Mouse YARS Protein | +Inquiry |
YARS-10248M | Recombinant Mouse YARS Protein, His (Fc)-Avi-tagged | +Inquiry |
YARS-207H | Recombinant Human YARS protein, T7/His-tagged | +Inquiry |
YARS-31445TH | Recombinant Human YARS, His-tagged | +Inquiry |
Yars-324M | Recombinant Mouse Yars Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YARS-249HCL | Recombinant Human YARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YARS Products
Required fields are marked with *
My Review for All YARS Products
Required fields are marked with *