Recombinant Human YARS protein, T7/His-tagged

• Cat.No.: YARS-207H
• Product Overview: Recombinant human YARS N-terminal fragment (Mini-TyrRA) cDNA (2 – 364 aa, derived from BC016689) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 2-364 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGK PHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTD YQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEK YLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLK SEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQ KPMAKGPAKNSEPEEVI
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro Mini-YARS protein mediated interleukine-8 like activities regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for Mini-YARS protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. May be used for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: YARS tyrosyl-tRNA synthetase [ Homo sapiens ]
• Official Symbol: YARS
• Synonyms: YARS; tyrosyl-tRNA synthetase; tyrosine--tRNA ligase, cytoplasmic; tyrosine tRNA ligase 1; cytoplasmic; tyrRS; YRS; YTS; tyrosyl--tRNA ligase; tyrosine tRNA ligase 1, cytoplasmic; tyrosyl-tRNA synthetase, cytoplasmic; TYRRS; CMTDIC
• Gene ID: 8565
• mRNA Refseq: NM_003680
• Protein Refseq: NP_003671
• MIM: 603623
• UniProt ID: P54577
• Chromosome Location: 1p35.1
• Pathway: Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem
• Function: ATP binding; interleukin-8 receptor binding; ligase activity; nucleotide binding; signal transducer activity; tRNA binding; tyrosine-tRNA ligase activity