Recombinant Human YEATS4 protein, GST-tagged
Cat.No. : | YEATS4-3764H |
Product Overview : | Recombinant Human YEATS4 protein(1-227 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-227 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | YEATS4 |
Synonyms | YEATS4; YEATS domain containing 4; YEATS domain-containing protein 4; GAS41; NuBI 1; YAF9; nuBI1; NuMA binding protein 1; nuMA-binding protein 1; glioma-amplified sequence 41; glioma-amplified sequence-41; NUBI-1; 4930573H17Rik; B230215M10Rik; |
Gene ID | 8089 |
mRNA Refseq | NM_006530 |
Protein Refseq | NP_006521 |
MIM | 602116 |
UniProt ID | O95619 |
◆ Recombinant Proteins | ||
YEATS4-1536H | Recombinant Human YEATS Domain Containing 4, T7-tagged | +Inquiry |
YEATS4-3859H | Recombinant Human YEATS4 protein, His-tagged | +Inquiry |
YEATS4-3542C | Recombinant Chicken YEATS4 | +Inquiry |
YEATS4-3764H | Recombinant Human YEATS4 protein, GST-tagged | +Inquiry |
YEATS4-26355TH | Recombinant Human YEATS4, T7 -tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YEATS4-248HCL | Recombinant Human YEATS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YEATS4 Products
Required fields are marked with *
My Review for All YEATS4 Products
Required fields are marked with *