Recombinant Human YEATS4 protein, GST-tagged
| Cat.No. : | YEATS4-3764H |
| Product Overview : | Recombinant Human YEATS4 protein(1-227 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-227 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | YEATS4 |
| Synonyms | YEATS4; YEATS domain containing 4; YEATS domain-containing protein 4; GAS41; NuBI 1; YAF9; nuBI1; NuMA binding protein 1; nuMA-binding protein 1; glioma-amplified sequence 41; glioma-amplified sequence-41; NUBI-1; 4930573H17Rik; B230215M10Rik; |
| Gene ID | 8089 |
| mRNA Refseq | NM_006530 |
| Protein Refseq | NP_006521 |
| MIM | 602116 |
| UniProt ID | O95619 |
| ◆ Recombinant Proteins | ||
| YEATS4-18656M | Recombinant Mouse YEATS4 Protein | +Inquiry |
| YEATS4-848Z | Recombinant Zebrafish YEATS4 | +Inquiry |
| YEATS4-269H | Recombinant Human YEATS4 protein, GST-tagged | +Inquiry |
| YEATS4-3764H | Recombinant Human YEATS4 protein, GST-tagged | +Inquiry |
| YEATS4-10252M | Recombinant Mouse YEATS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YEATS4-248HCL | Recombinant Human YEATS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YEATS4 Products
Required fields are marked with *
My Review for All YEATS4 Products
Required fields are marked with *
