Recombinant Human YEATS4 protein, GST-tagged

Cat.No. : YEATS4-3764H
Product Overview : Recombinant Human YEATS4 protein(1-227 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability September 08, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-227 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol YEATS4
Synonyms YEATS4; YEATS domain containing 4; YEATS domain-containing protein 4; GAS41; NuBI 1; YAF9; nuBI1; NuMA binding protein 1; nuMA-binding protein 1; glioma-amplified sequence 41; glioma-amplified sequence-41; NUBI-1; 4930573H17Rik; B230215M10Rik;
Gene ID 8089
mRNA Refseq NM_006530
Protein Refseq NP_006521
MIM 602116
UniProt ID O95619

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YEATS4 Products

Required fields are marked with *

My Review for All YEATS4 Products

Required fields are marked with *

0
cart-icon
0
compare icon