Recombinant Human YEATS4, His-tagged
Cat.No. : | YEATS4-28475TH |
Product Overview : | Recombinant full length Human GAS41 with N terminal His tag; 250 amino acids with tag, Predicted MWt 28.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 227 amino acids |
Description : | The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. |
Conjugation : | HIS |
Molecular Weight : | 28.900kDa inclusive of tags |
Tissue specificity : | Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.03% DTT, 1.17% Sodium chloride, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMFKRMAEFGPDSGGRVK GVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNE DMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFE IIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSE FYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEV KTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRK LEEDDQAKDI |
Sequence Similarities : | Contains 1 YEATS domain. |
Gene Name | YEATS4 YEATS domain containing 4 [ Homo sapiens ] |
Official Symbol | YEATS4 |
Synonyms | YEATS4; YEATS domain containing 4; YEATS domain-containing protein 4; GAS41; NuBI 1; YAF9; |
Gene ID | 8089 |
mRNA Refseq | NM_006530 |
Protein Refseq | NP_006521 |
MIM | 602116 |
Uniprot ID | O95619 |
Chromosome Location | 12q13-q15 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; |
Function | DNA binding; protein C-terminus binding; protein binding; sequence-specific DNA binding transcription factor activity; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
YEATS4-3764H | Recombinant Human YEATS4 protein, GST-tagged | +Inquiry |
YEATS4-269H | Recombinant Human YEATS4 protein, GST-tagged | +Inquiry |
YEATS4-271H | Recombinant Human YEATS4 protein, GST-tagged | +Inquiry |
YEATS4-270H | Recombinant Human YEATS4 protein, GST-tagged | +Inquiry |
YEATS4-1536H | Recombinant Human YEATS Domain Containing 4, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YEATS4-248HCL | Recombinant Human YEATS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YEATS4 Products
Required fields are marked with *
My Review for All YEATS4 Products
Required fields are marked with *
0
Inquiry Basket