Recombinant Human YPEL4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | YPEL4-4092H |
Product Overview : | YPEL4 MS Standard C13 and N15-labeled recombinant protein (NP_659445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | YPEL4 (Yippee Like 4) is a Protein Coding gene. An important paralog of this gene is YPEL3. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPAEQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | YPEL4 yippee like 4 [ Homo sapiens (human) ] |
Official Symbol | YPEL4 |
Synonyms | YPEL4; yippee like 4; protein yippee-like 4 |
Gene ID | 219539 |
mRNA Refseq | NM_145008 |
Protein Refseq | NP_659445 |
MIM | 609725 |
UniProt ID | Q96NS1 |
◆ Recombinant Proteins | ||
YPEL4-5055R | Recombinant Rhesus Macaque YPEL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
YPEL4-4092H | Recombinant Human YPEL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YPEL4-6634R | Recombinant Rat YPEL4 Protein | +Inquiry |
Ypel4-7036M | Recombinant Mouse Ypel4 Protein, Myc/DDK-tagged | +Inquiry |
YPEL4-6290R | Recombinant Rat YPEL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YPEL4-239HCL | Recombinant Human YPEL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YPEL4 Products
Required fields are marked with *
My Review for All YPEL4 Products
Required fields are marked with *